SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150741|ref|YP_001404359.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150741|ref|YP_001404359.1|
Domain Number 1 Region: 239-488
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.03e-21
Family TM0894-like 0.095
Further Details:      
 
Weak hits

Sequence:  gi|154150741|ref|YP_001404359.1|
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily ACT-like 0.00055
Family Phenylalanine metabolism regulatory domain 0.074
Further Details:      
 
Domain Number - Region: 87-148
Classification Level Classification E-value
Superfamily ACT-like 0.0143
Family BT0572-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150741|ref|YP_001404359.1|
Sequence length 509
Comment beta-lactamase domain-containing protein [Methanoregula boonei 6A8]
Sequence
MTAPSARKFGFIAHMPDEPGSLEQAAQVITRYNGNINRIQYDRRIDPCTVFYEVTSTEEE
YARITGDLADIGYLQTSLQPVSFLKFFVHLPHAPGSLHRFLKFTTESGANIGFIDFDDTG
RFPDRLTVSLNLEDPAAVENLLDQLKSRYHLEILEYDTTGKHLDDTVFYVKFAQEIRDLI
GESENEFLLSFLADTNHIAQELMNRGNNPRQVFDSVLLTGRTLRATTGKNFYADVQKIQI
TPAVSLFCFQLPCGGSIYVLFSGKEALMIDTGYGIYHDDVMAMFSSFGLGEEGNFTGLVI
THADADHCGGGGFFSAGAVMHTGTRDIIKTNNRAYGSRSEHSVLESFYTKMINCFSRFNP
PGNVTCLQKAGTSVQSIFPVLGSVAIAGIRLEILEGLGGHTHGQIYLYSREEGLLFTADA
VINFSSLTPERASYSSLADFLVSSVNVDSDLARRERKALLELATETDRELARKGKRCLIC
GGHGAVSVLDKGRLVPCGEITRYQIPDAP
Download sequence
Identical sequences A7I7K5
WP_012106747.1.2930 gi|154150741|ref|YP_001404359.1| 456442.Mboo_1198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]