SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150781|ref|YP_001404399.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150781|ref|YP_001404399.1|
Domain Number 1 Region: 8-147
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 4.05e-32
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 149-309
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.21e-29
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000387
Further Details:      
 
Domain Number 3 Region: 312-411
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 4.71e-16
Family Glutamyl tRNA-reductase dimerization domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150781|ref|YP_001404399.1|
Sequence length 424
Comment glutamyl-tRNA reductase [Methanoregula boonei 6A8]
Sequence
MSKHPSRFAVAGVSHHTADVLALEAFRFGDEPAFLAAAQKKFAGALLLQTCNRVEVIVEG
DAASLRDFLESQERKGFFLLEGREALRHLFSLAAGIDSMIVGEDQIIGQLKKSLADGEAA
CTASPFLSLCINKAVHVGVGVRRTTKINRGAVSVGSAAVLLAESELGTLEGRHILVVGSG
EMGLLVAQALAAKHLTAMYVANRTFGRAVILAEKIGGVAVRMNELYHYITLSDVVISCTS
APHPVIHKTALKEAMRDRCWPVEGHPRPLILVDIAQPRDVEEGAGAIDGVRLFTIDDLRQ
VNEQTMSTRRAEAERAAEYVDDELDLFIRQLHRKSADDCIAALHTWAEAVRVRERDRALA
RLGNMDERTAGVIDDLSRVLTKKILTDATASIRACAEEGDRDAAEALVRALTRGSAADSR
EGTE
Download sequence
Identical sequences A7I7P5
456442.Mboo_1238 WP_012106787.1.2930 gi|154150781|ref|YP_001404399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]