SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150791|ref|YP_001404409.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150791|ref|YP_001404409.1|
Domain Number 1 Region: 694-960
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.49e-63
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000856
Further Details:      
 
Domain Number 2 Region: 443-695
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000811
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|154150791|ref|YP_001404409.1|
Domain Number - Region: 148-193
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0248
Family HAMP domain 0.012
Further Details:      
 
Domain Number - Region: 239-283
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0288
Family HAMP domain 0.012
Further Details:      
 
Domain Number - Region: 331-374
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0366
Family HAMP domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154150791|ref|YP_001404409.1|
Sequence length 981
Comment methyl-accepting chemotaxis sensory transducer [Methanoregula boonei 6A8]
Sequence
MTFIDEMKLGKEFNTLLVDIEHMSDAHDKGDIDVLIPVEKYQGSAKTAAQCINNMVNGHI
TVKKKAMATVAEFAKGNFEAPLEKFPGKKAFINDNIELLRTNLKALVADANMLSKAAVEG
KLDTRADASKHQGDYHKIVQGVNDTLDSVIGPLNVAAEYVDRISKGDVPAKITDNYNGDF
NEIKNNLNQCIDAVNLLVKDANLLSKAAVEGKLDTRADASKHEGDFRKIVEGVNQTLDSV
IGPLNVAAEYVDRISKGDVPAKITDNYNGDFNEIKNNLNQCIDAVNLLVADANMLSRAAV
EGKLDTRADASKHQGDFRKIVQGVDDCLDAVIGPLNVAAEYVDRISKGDVPAKITDNYNG
DFNEIKNNLNQCIDAVNLLVQEANMLSKAAIEGKLSTRADASKHQGDFRKIVQGVDDCLD
AVIGPLNVAADYVDKISKGNIPSRITDNYNGDFNVIKNNLNQCIDAVNLLVQDANMLSKA
AVEGKLDTRADASRHQGDFRKIVQGVDDCLDSVIGPLNVAADYVDKISKGNIPARITDNY
NGDFNVIKNNLNQCIDAVNLLVKDANMLSEAAVAGKLGTRADASKHQGDFKKIVDGVNDT
LDAVIDPVNEAMRISDEYAKQNFTARVNEDLQVRGDFIRFKKSLNNVGIQVSSALSKVND
RVNELSASAQEASASAEEVSAGSNQVAKNAGAVSSNADKSGEGIKQVLKAMEDLSNTVQE
VASRADAVAQLAKQSEELSRKGTDLANKADRGMDGITKSSAEVNTIILDIKSQMDKIGDI
VVLIANLANQTNLLALNAAIEAARAGEAGRGFAVVATEVKSLAEESENSAEKIRQMIGEL
QKQTQRAVEAVESANDGVREGSGALTQTLEVFNKIVTSIDDINKNISSVAASAEEQAASV
EEVTASVTTVSTLISETAKEATDAAAATEEASASIDQITKVIQNVNTIVEDVSHEIAGFK
VDASVRISADRGAASNTASAQ
Download sequence
Identical sequences A7I7Q5
gi|154150791|ref|YP_001404409.1| 456442.Mboo_1248 WP_012106797.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]