SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150806|ref|YP_001404424.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150806|ref|YP_001404424.1|
Domain Number 1 Region: 220-400
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.16e-41
Family PAPS reductase-like 0.058
Further Details:      
 
Domain Number 2 Region: 124-196
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000000000204
Family PUA domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154150806|ref|YP_001404424.1|
Sequence length 464
Comment hypothetical protein Mboo_1263 [Methanoregula boonei 6A8]
Sequence
MHPSYLGRILLSWCDRCHTPVLGKTCAACGSPTRKVPLTPPGDARPAFPADIELINRIFC
EHFGAPLVPEGHLVLLNKVPDTDRMEEIIIGGGIAGSIRYLPKKRRWEPIPRPEACTLFY
PIQRVVTVDDTAVPFIRDQGMSVLRPGMASIEDHVDTGDEVFILAKDGTCIAVGRAKAGA
EEARAMQKGQVVRTRRNTPSTIVPGRATWKDAVRSNAAVLDRVETEAVTFVKNVARAYPL
QPTISYSGGKDSLATFLVVKKALGNVPLLFADTGLEFPETYANVDAMEHQYQAKIIRTPA
AEKFWTTLARQGPPAVNARWCCSICKLLPVAETIRSTWGECLSFIGQRRYESLSRAQSDR
IWRNAIVKVQLSAAPIQDWTALHVWLYLFREEAPYNQLYEHRLDRIGCFMCPSSDMALIH
MIEADFPGLWSGWMKHLEAWRDAQGLPAGWIESGAWRIREEKHG
Download sequence
Identical sequences A7I7S0
456442.Mboo_1263 gi|154150806|ref|YP_001404424.1| WP_012106813.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]