SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150810|ref|YP_001404428.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150810|ref|YP_001404428.1|
Domain Number 1 Region: 58-260
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.82e-54
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00052
Further Details:      
 
Domain Number 2 Region: 308-495
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.83e-40
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00033
Further Details:      
 
Domain Number 3 Region: 596-754
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.44e-39
Family AlaX-like 0.011
Further Details:      
 
Domain Number 4 Region: 510-595
Classification Level Classification E-value
Superfamily Translation proteins 5.3e-17
Family AlaX-M N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154150810|ref|YP_001404428.1|
Sequence length 914
Comment alanyl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
MLEEEYQLDYFKEQGFTRKICKSCGSAFWTRDSSREDCGDAPCVPYSFIGSPVFAPHTVD
EMREAFLSFFEKNGHTRIERYPVAARWRDDIYLTIASIADFQPFVTAGVVPPPANPLTIS
QPCIRLNDLDSVGRSGRHLTTFEMLAHHAFNTPTEEIYWKDRTVELCDQFLASIGGDLNK
VTYKEHPWIGGGNAGPSVEVMIGGLEVATLVFMSLGRQKTSHPGYDLNGEKYYPMKLRIV
DTGYGLERLVWASKGSPTIYDAVFPDMVSRVMSSAGISHLLENKDYTKILAMNARFAGLM
DISGSNLFNLRKKVAAAIEISPEKLDRMITPIEKVYAIVDHTRCLAYMLGDCIVPSNVRE
GYLARLVIRRTLRMMNEFKMQDTLADLIEEQMKIIGMDKFQQDIAVVREIVDREVEKYAI
TLDRGTRIVQKVAKSYKAKSQRVPLAEIITLYDSHGIPPEMIKDIAAKEGAVIDLPDNFY
SQIADMHSESKKEAAPDKTAGYAERVSALPPTKKLYYEQPGDTEFEAVVIDFFDEYAVLD
QTLFYPEGGGQPADTGSLVGSDSMARVDDVIKVGEVILHHISGGVLQRGERVKGMIDEER
RFSLMRHHTATHILLHAAKAVLGVHIHQSGAQKGPESSRIDIRHFKHITPDELRKIEIEA
NRMVMANRPVEISIENRTKAEQEYGFALYQGGVPPGKDLRIVKVAGDIEACAGTHCRSTG
EIGAIKILRVEHIQDGIERIEFAAGTAAVYYMQHLEQIAASSADVLSVQLENLPPTVTRF
FSEWKDQKKEIERMSQRLVELEIQAIQPESIGGIPVVVKRIDLAPRELSSIATSLSEKGG
VALLATPGETARIVLASGDARVNAGDIIGQLCSLLGGKGGGKPQMAQGGGPEVDKLDLAL
NVGRERIIAALQKK
Download sequence
Identical sequences A7I7S4
gi|154150810|ref|YP_001404428.1| WP_012106817.1.2930 456442.Mboo_1267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]