SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150880|ref|YP_001404498.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150880|ref|YP_001404498.1|
Domain Number 1 Region: 147-340
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.71e-54
Family Methylesterase CheB, C-terminal domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily CheY-like 1.99e-33
Family CheY-related 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150880|ref|YP_001404498.1|
Sequence length 350
Comment response regulator receiver modulated CheB methylesterase [Methanoregula boonei 6A8]
Sequence
MVKVLIVDDSVFMRTVIRDMLQKDPSIEIVGTASNGLEALEKIKSLRPDLITLDIEMPRM
NGLEVLRELKKAAWHPRTLMLSSLTSEGAEMTAEAIRLGADDFMLKPKDVPQLRLIADEL
VATIHHLTSSPPASKKEALTVSHREGSAERVVLIGSSAGGPPMLDAILAKLPADFPACVV
LTQHMPVGFTAPLAARFNRLAHMPVKETENGDMLREGSVFLSKAGVHTMIGAALTADGKR
TGRVIHSSAPPIHGVRPAVDKTFESAAQVFGKNAVAVILSGMGNDAGAGAAAIKEAGGTI
ILCDQKDCLVYGMARSAIQHNAVDQVLPLSKIPEAIERIVGKMAAEGSHV
Download sequence
Identical sequences A7I7Z4
456442.Mboo_1337 WP_012106888.1.2930 gi|154150880|ref|YP_001404498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]