SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150975|ref|YP_001404593.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154150975|ref|YP_001404593.1|
Domain Number - Region: 175-196
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0439
Family Ribosomal protein S27a 0.08
Further Details:      
 
Domain Number - Region: 29-119
Classification Level Classification E-value
Superfamily PH domain-like 0.0547
Family BPHL domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154150975|ref|YP_001404593.1|
Sequence length 529
Comment hypothetical protein Mboo_1432 [Methanoregula boonei 6A8]
Sequence
MGYPDLKSDESIVLTAQHVKVKSVPFELVLTNRRLIIIDSEKNVVPTQQITLFSIRNVMA
SENAIRDPVITLTIQTDAAETREMALTFVRQSAGERRREADEWAKSLRKYISEAASQPGD
FATGAPAAFESRPDHGVTPGIKKKIEIAGPIKRITVDTSHLPPKPVESTSLPEGSFCGRC
GNRIPPGSTFCNRCGTRVNVPSEEVPAPVAAPQIATAPAATAGAGERKISGGRPIEQIIH
SIEPLIEDSVPRTGSSPAVPEPFVPAPATREAESSVPAPETPAPAQESVVPSEGIAPAAT
AAPAPAEGEQIPAAAIPPAPPIPPVPAAPRKGGRKILAAAIIVILVIAVVAGGLFVLPAL
NKSAVVTPTPTPTPVPTTATPTPTPTPVPTSVVTTVAVTTTPQSLVPQSGVWAEVTYDNT
YSGQVGVPGSQASVSDTGDHFYRIPTVDGIVAITLKKTDGSGDELKVVLYKDGAVVTTAS
TKAPYGTVDMQFSLPAASTPTPTVAILTATPTATLTGSNATANKTASSL
Download sequence
Identical sequences A7I889
WP_012106983.1.2930 gi|154150975|ref|YP_001404593.1| 456442.Mboo_1432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]