SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154150976|ref|YP_001404594.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154150976|ref|YP_001404594.1|
Domain Number 1 Region: 119-420
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.29e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000671
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily tRNA-binding arm 4.01e-24
Family Seryl-tRNA synthetase (SerRS) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154150976|ref|YP_001404594.1|
Sequence length 425
Comment seryl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
MLEIRFVRASPDVVKADLERRGTPEKIAWVDEILAKDARSRELKVQTDELRRRRNTIARE
INEARKTGKDAAPLLREAAELPQKIKANDAEQEEISGIIRTRLMRLPNILHESVPKGKDD
TENVEIRRVGTPRTFDFELKNHGQLAADNGWADFERAAKTSGAGFYFLKGGLVMLDLALQ
RFALDLLGKKGFTPVIPPFMIKRDSYEGVTDLDDFEKVMYKIDGDDTYLIATSEHPIAAM
YQDEIFEEKDLPLRLCGLSPCFRREIGAHGLDTKGLFRVHQFTKIEQFVFCRPENSWQIH
EELLANAEEVFTKLGLPYHVVNICTGDIGTVAAKKYDIEAWMPRENAYKEVVSCSNCTSY
QAASLNIRVRDKENFETKHLVHTLNSTAIATSRALRCILENYQNRDGSVTIPDVLRQYMN
DREFL
Download sequence
Identical sequences A7I890
WP_012106984.1.2930 gi|154150976|ref|YP_001404594.1| 456442.Mboo_1433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]