SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151000|ref|YP_001404618.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151000|ref|YP_001404618.1|
Domain Number 1 Region: 13-140
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.26e-42
Family AF0055-like 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151000|ref|YP_001404618.1|
Sequence length 146
Comment hypothetical protein Mboo_1457 [Methanoregula boonei 6A8]
Sequence
MIIFNHLCGVILLITGRSISRGRGTGKLLVSPEPISFLSGVDPETGIVVEKGHPLEGTSV
AGTVLVFPYGKGSTVGSYVIYALSRNGHAPAAIVNTEAEPIIATGAIIGNIPMIDRPKIP
LDRLMTGTQAIVDGDAGTLEYDGTPV
Download sequence
Identical sequences A7I8B4
456442.Mboo_1457 gi|154151000|ref|YP_001404618.1| WP_012107010.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]