SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151111|ref|YP_001404729.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151111|ref|YP_001404729.1|
Domain Number 1 Region: 38-139,170-310
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.41e-30
Family Zn metallo-beta-lactamase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151111|ref|YP_001404729.1|
Sequence length 312
Comment beta-lactamase domain-containing protein [Methanoregula boonei 6A8]
Sequence
MISMTNVSLKAADRTEITVLVDNYIDIFVPQATPVDHRLLFDPCRHLMAEHGFSCLVRVF
SGKQEHAILMDTGLSRECMAWNARQLKIPLGGIEAVVLSHGHFDHIGGLPAAVSGAGRQV
PLVLHPDAFLARRINGKNGIAELPGIDAVALKKAGADILGREGPSTLAAGRLLVTGEIER
TTSFETGMPGMEMFDKSAWLPDPIRDDQAIVIKVKDKGLVVLSGCAHAGIANTVKYAQKI
TGTEKVHAVLGGFHLTGPAFAPRIQPTVAAIKEINPDYVVPMHCTGWDAINQFMAAMPEK
CILNTVGTRYIF
Download sequence
Identical sequences A7I8M5
456442.Mboo_1569 gi|154151111|ref|YP_001404729.1| WP_012107129.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]