SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151122|ref|YP_001404740.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151122|ref|YP_001404740.1|
Domain Number 1 Region: 630-664,697-965
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.45e-61
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 216-338
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000314
Family BphP N-terminal domain-like 0.046
Further Details:      
 
Domain Number 3 Region: 336-453
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000314
Family Flavin-binding PAS domain 0.079
Further Details:      
 
Domain Number 4 Region: 489-593
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000262
Family N-terminal PAS domain of Pas kinase 0.065
Further Details:      
 
Domain Number 5 Region: 106-209
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000166
Family Flavin-binding PAS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151122|ref|YP_001404740.1|
Sequence length 967
Comment methyl-accepting chemotaxis sensory transducer [Methanoregula boonei 6A8]
Sequence
MTEQRPGRKALFVGAQAPAAVRTTPDEIAQKVRDLNEELALALKGAHAKKAVPPLDPAHF
GSEYTTLVDAVNTAAAQMTAPAPGVPAPGEMLPEMLAEYGKKIDVLERRLEFMEKNNPVP
MLIATPALDITEANAAYVALTGIPEDKIVKTNLHDFTITDRSGEGAREAIEKKRRAVGEL
TVTFPSGVHTLEQYCIPVLDSSGAVTSLVILYDDLTTKKKKNEEIERLKARSETIVQQNP
MPIVLVDTGFIIKVVNDAFVALAGREKDQLLSRSLNDLAITQQAGDGLKKVLETGTRSEG
EVVIESQGKAHRLRQYGIPIPGAKGAIENILVVYNDITGEKQEAGEGLDTRNLSEALIRE
NPIPILITDRSFTIISANTAFEKLSGYTPDRITGMNLRGIKIREQKGEGAGIAIREKRRA
SGEVTVDLPSGTKILEQYVMPLLDAKNSIEHLLLVYYDVTAQRASQQDLAKKMEEVAALK
KRSDIIVMQNPMPIMLMDPSFKILMANEAYTNLTGLSKEKIHGMSAREFKILSQSGEGLK
KVLEKKARSYGEVTIEFPRGLRILEQYGIPMLDAQQNLSTILCVYVDVTARREQENKIRA
MMDEAKANAELLSASAAELQTGLARIAAGDLTYQLSIDEADPLVRLKKDYNSSVAAIRSV
IAELMQSIRKLDVTIQDTIKSTDEIAKATEQVAISSQKATDNSKEQLAGVEKISVTVSDI
SASIEEIASTSHDVMAHAGKAAEEGSHAASVGKTATDKMQAVEKISQQSVNEITALNEQM
RQITKIVNLITDIANQTNLLALNAAIEAARAGEHGRGFAVVAGEVKNLAGESKKASNQIE
TLIKAIQTKSEVTATSIQDSFVQIKGGIESVNMTVESLNKIIAEASVVSQGLAEITKATE
SQAQATSGLMAGIDTLRRSTENNQHRMEDMAALAQETSASTEEIASASAELSIMAERCSG
MMKEFHT
Download sequence
Identical sequences A7I8N6
gi|154151122|ref|YP_001404740.1| 456442.Mboo_1580 WP_012107140.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]