SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151146|ref|YP_001404764.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151146|ref|YP_001404764.1|
Domain Number 1 Region: 155-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.35e-97
Family Extended AAA-ATPase domain 0.000000000728
Further Details:      
 
Domain Number 2 Region: 544-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-81
Family Extended AAA-ATPase domain 0.00000000752
Further Details:      
 
Domain Number 3 Region: 4-154
Classification Level Classification E-value
Superfamily Double Clp-N motif 2.22e-32
Family Double Clp-N motif 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151146|ref|YP_001404764.1|
Sequence length 863
Comment ATPase [Methanoregula boonei 6A8]
Sequence
MNFNNFTIKSQEAVSKAIELATAKKNPSVETSHLLKGMLLVDENVIPYLLKKLNVDLNGF
TPALDRIIDAYPEVTGGDQHLSSDATKALQKATALSQESGDEFVSLEQILLGILSVDNST
SRLLKENGVKEKDLKTAIGQLRKGETVNNQNAEETYNALEKYARNLNDLARKGKLDPVIG
RDEEIRRVLQILSRRTKNNPILIGEPGVGKTAIAEGIAHRIIDEDVPDNLKTKQIFSLDM
GALIAGAKFKGEFEERLKSVVKEVTSSDGEIILFIDEIHTLVGAGGGEGAMDAANILKPA
LSRGELHVIGATTLKEYQKYFEKDKALERRFQPVMVNEPDMQDAISILRGIKEKYETHHH
VRIKDEAIIAAVELSQRYISDRFLPDKAIDLIDEAASKLRLEINSKPEELEKIERKIHQL
EIEREAIKREKDQQKLKALNEEIGNLTEERNRLNAKWRSEKELVEQIQSRKTEIEDLKFE
AERAERNGDLGKVAEIRYGRIPDNEKSMVALKEKLTVLQKDSALVNEEVDAEEIAEVVSR
WTGIPVSRMLQSEREKLLSLEAELHKRVVGQDEAIAAVSNAIRRSRAGLQDTKRPIGSFI
FLGTTGVGKTELAKALAEFLFNNENSMVRIDMSEYQERHTVSRLIGAPPGYVGYEESGQL
TEAVRRKPYSVVLLDEIEKAHPDVFNILLQVLDDGRLTDNKGRTVDFKNTIIIMTSNIGS
HLIQENMEKATEKDRDELFERTREQVFDLLKKTIRPEFLNRIDEIIMFKPLTEDEIRTVV
EIQLEGVQKMLEKSDVRLTATKKAIRFIAALGFDPQFGARPIKRVIQKNLLNELSKMILE
GKVQKDKEIVVDEKGGKLVFGNA
Download sequence
Identical sequences A7I8R0
gi|154151146|ref|YP_001404764.1| 456442.Mboo_1604 WP_012107165.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]