SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151175|ref|YP_001404793.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151175|ref|YP_001404793.1|
Domain Number 1 Region: 39-496
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 5.75e-166
Family Type II DNA topoisomerase 0.000000000556
Further Details:      
 
Domain Number 2 Region: 508-817
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.18e-90
Family GyrA/ParC C-terminal domain-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154151175|ref|YP_001404793.1|
Sequence length 829
Comment DNA gyrase subunit A [Methanoregula boonei 6A8]
Sequence
MTSEVPPAGTPETHKTEPISIEQEMKTSFINYAMSVIIQRAIPDVRDGLKPVHRRSLYAM
WDMGNTSDKPTKKSARVVGDVMGKYHPHGDASIYDTIVKMAQPFSYRHPLVQGQGNFGSV
DGDAAAASRYTEVRLFPYAEALLEDLDKETVEFVPNYDESLKEPTVLPSKIPNLLVNGTD
GIAVGMATKMPPHNLREVCAAVNRFLDEPSVPVEELLKIMPGPDFPTGGILMGVDGVKNI
YATGQGRIVVRGVAEIEESEGGNRGDRIIVTELPYQVNKAQWITAIADMVKDKKLDGISD
IRDESDKDGIRVVFELRKGTISAVILNNLYRFTALESGFSAYNLAIVDGTPKLLNLPALL
GNFVHHRIEVIRRRSEFDLKKCQERVHILNGLLTALASIDKIIAAIRGSDTVDNARIALI
SGFGLDELQANAILQMQLRRLAALEQQKIVDEKSTLEAEILKLETILASEENIKDEIRRE
TSEIALKFGDARRTEITLDASDLSTEDLIEDKTVLVSITTANYIKRMDLDTYRKQRRGGH
GITGMTTKEDDVVSSVFAAGMKDYLLCFTNIGRVYWLKVYQIPESSRIAKGKPIVNLLNL
KDEVVTTVIPIREFRKDRYLLFATQLGQVIKIPQDEFSFPRSTGTNAIRLRENDKLVDVI
TTDNTKEVVLSTRFGYGLRFHEDTVRIVGRGASGVIGMRLRGNDTIVALTLVEKDHLLSI
TDAGFGKRTEFDDFRGHGRATMGVKNMQVERDVVIHSRAVADTDEIFVMTASGVVIRTSV
NSIRITGRGAKGVKIMRLDEKDKVIGVAIVTPEPGVEADPEPPAPVSPE
Download sequence
Identical sequences A7I8T9
WP_012107196.1.2930 456442.Mboo_1633 gi|154151175|ref|YP_001404793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]