SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154151198|ref|YP_001404816.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151198|ref|YP_001404816.1|
Domain Number 1 Region: 101-185
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.00000906
Family Class III anaerobic ribonucleotide reductase NRDD subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151198|ref|YP_001404816.1|
Sequence length 251
Comment IS605 family transposase OrfB [Methanoregula boonei 6A8]
Sequence
MIKVHLTAHAPARWIGVDLNTTGHAAVAAEPDSGKVLKLGKNVHYVRSNSIKNCTKLYKE
GKLWKLKKVKSRERKAFKAALSKISRQIVSFAESLGTGIKFEKLFSSRYSHSHDAGGFVE
FSFANGSFFSLQRLVEKMAERKGIPVIYVNPAYTSKRCSRCGSMGRRSRKRFECPHCGFV
AHADVNAAFNIALTSRRSSLLNFTEEEQDEHVRLTKKQVRRRVREEIFSHHPVIPGGTVQ
APCENLLAVLE
Download sequence
Identical sequences A7I8W2
456442.Mboo_1656 gi|154151198|ref|YP_001404816.1| WP_012107219.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]