SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151224|ref|YP_001404842.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151224|ref|YP_001404842.1|
Domain Number 1 Region: 56-600
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.4e-151
Family Acetyl-CoA synthetase-like 0.000000542
Further Details:      
 
Weak hits

Sequence:  gi|154151224|ref|YP_001404842.1|
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00325
Family CopG-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151224|ref|YP_001404842.1|
Sequence length 609
Comment AMP-dependent synthetase/ligase [Methanoregula boonei 6A8]
Sequence
MVRYSISMDDTLTEKIDRLCEQKKISRSDWISEACTGHLTTSATGPAGTLPVPAAFRHNM
EDYDTTYRDFRINVPEYFNFGFDVIDAWAKKDRNKLAMIWTNQKGEEKKFTFWDLMRLSN
QIVNMLIKYGVSKGDRVMIMLPRVPEWWIATIALIKRGAVYCPAPTMLTEHDLKYRINAA
EIKMVITSQDQADKIDAIKNDCPSLSCRFLIDGKRDGWISYPVELDYPAPVSAKLVNLPG
MKKTKATDPMVIFFTSGTTGEAKMVVHSQSYALGHITTSRFWHDVHENDLHFTFSDTGWA
KSAWGKLYGPWLEGAAIFVYDIRGRFNATELLPLIERYGINTFCCPPTIYRMLILADLDK
FDFTELRHCVSAGEPLNPEVIKAWKDATGLTIYEGYGQTETVLCIGTFPCMEARYGSMGK
PSPGWVIELHDEKGKPVGIHEEGRIAIKVEPWPVGMFTGYLENPEENSKSFVNGWYYTGD
KAYKDEDGYFWFIGRDDDVIKASGYRIGPFEVESALIEHPSVQEAAVVGSPDDIRGLIVK
AFVILKPGFAPSDALVRDLQTHVKKVTAPYKYPRAIEFVDSLPKTISGKIRRIELRDREL
KRFSAGQKQ
Download sequence
Identical sequences A7I8Y8
gi|154151224|ref|YP_001404842.1| 456442.Mboo_1682 WP_012107245.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]