SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151251|ref|YP_001404869.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151251|ref|YP_001404869.1|
Domain Number 1 Region: 131-701
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.01e-117
Family Class III anaerobic ribonucleotide reductase NRDD subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154151251|ref|YP_001404869.1|
Sequence length 729
Comment anaerobic ribonucleoside-triphosphate reductase [Methanoregula boonei 6A8]
Sequence
MPARRETRQLTFGGGFSPALPPVRTTDGHIVDWDRNRIAEQIKKETKLVESFYGYEGADD
ATAQEIAREVEQRILALGLKSLSGPLIREIMNITLLEKGMVQYRNVCTRVGTPVYDAHQI
DVGKGFEAHDNANLQENAETSHKKKADKISKEQYLLQLPPELADHHLCGEMHIHDLEYFG
TRPFCQDWDLRYFFYYGLMPDGNGTKASVAGPAKRAEVAILHAVKALGSAQTNFAGGQGY
YNFLTFLAPYMEGMSYDEIKQNMQMFVYEMTQMMVARGGQLVFSSVQLSPGVPTLWQDKP
CVFKGKIWDGKEAPRRTYGEFEREVRLLFKALMDVMIEGDYWGKPFNFPKPEISIEPDFT
KEREEFNRNHPDLPTFRDLYLMTFELASKFGTPYYDNQLPAYRGAGKGISCYQCCAYQFS
TVADKDSEFDKKLLFEGGRHFSMGSWQVVSVNCPRAAYNAEGKDERLFAELRALMDVAVE
LFKIKRRWMNNIRASGRMPFAMQRPKDPNTGDRGAIAVDLEGLVYTIGVVGVNEMVQHHT
GQQVHESKAAFKLAIRAMTEMELYARKLSAKNNMTIALARTPAETTGQRFAVADLIDKRY
HDMAAKVIKGDLDYALNNLGKTRDLPIYYTNGTHVAPGANVPLTKRMEIEHVFFPIVDGG
NIFHIWLGEARPDPRGLMDMAMNLCRNTQIGYFAFTRDLTVPLRQFREFRPEKRAEGSWM
PPADVPAKA
Download sequence
Identical sequences A7I915
gi|154151251|ref|YP_001404869.1| WP_012107273.1.2930 456442.Mboo_1709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]