SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151276|ref|YP_001404894.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151276|ref|YP_001404894.1|
Domain Number 1 Region: 1-309
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.78e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000338
Further Details:      
 
Domain Number 2 Region: 323-405
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8e-17
Family Anticodon-binding domain of Class II aaRS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151276|ref|YP_001404894.1|
Sequence length 410
Comment histidyl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
MIQKPRGTRDFLPDEMEARRSIEAKMREAVRRFGYREVCTPEFEELELFTLRSGEGIMQE
MYVFEDKGGRKLALRPEITAAVIRMYINEAKVAPKPLRWCYFADCFRYERPQKGRYRQFW
QFGAELIGADTALADAEVIMLAAEALNATGVTWELKVGHLAFMKNLLADLDPAAQRRVMA
HLDKKDFEGLAETLAGMRKSGLNDSLTALVECRTLAEAFEIAGTIPEKERVEQTMGILDA
SGVRYSLNFGIARGLDYYTGMVFEGFAENLGAENQILGGGAYRLAHLFGGDDVASCGFAI
GFDRVMVSLGEVFAAKDTIAGIVCTDEGRSFALSVAREFRAAGIRAEMDLMGRGLGAQLA
HASKTADFAVVIGKREADAGQVTLKNLHSGEQKTLDPAAAIAEVKAHGAR
Download sequence
Identical sequences A7I940
456442.Mboo_1734 gi|154151276|ref|YP_001404894.1| WP_012107299.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]