SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151330|ref|YP_001404948.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151330|ref|YP_001404948.1|
Domain Number 1 Region: 70-276
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.69e-48
Family Biotin holoenzyme synthetase 0.0002
Further Details:      
 
Domain Number 2 Region: 282-325
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.00000000421
Family Biotin repressor (BirA) 0.0017
Further Details:      
 
Domain Number 3 Region: 7-59
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000879
Family Biotin repressor-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154151330|ref|YP_001404948.1|
Sequence length 326
Comment biotin--acetyl-CoA-carboxylase ligase [Methanoregula boonei 6A8]
Sequence
MPDSAFKVMAVLEKADGPVSGEVISNELGITRAAVWKHINELRMMGYDISSSQKEGYRLT
RMSNKLLPYEIHKKLHTKFIGKKMRYLENTPSTIWAGKQLCAEGDVEKMHGMVIIAEEQT
GGVGRMGRAWVSPSGGIWVTVVLKPHIPIDHVFMITMAGSVAVARAIRKEFSLSALIKWP
NDIFIGNKKVAGLLLELAAESDTVHYCLLGMGIDANISLAQFAPGLRDLITSISAELGHE
VDRAAFLARVLKEFESQYLLVESGEYDTIIREWKSLSCTLEHRVDIRTLKNSFSGEAVDI
DEFGALIIRKDNGKLERVIAGDCFHQ
Download sequence
Identical sequences A7I994
WP_012107354.1.2930 gi|154151330|ref|YP_001404948.1| 456442.Mboo_1789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]