SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151462|ref|YP_001405080.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154151462|ref|YP_001405080.1|
Domain Number - Region: 82-142
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00107
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.018
Further Details:      
 
Domain Number - Region: 24-43
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.00772
Family MalF N-terminal region-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154151462|ref|YP_001405080.1|
Sequence length 197
Comment hypothetical protein Mboo_1922 [Methanoregula boonei 6A8]
Sequence
MIYTRCINCGSPLPELPQHEGIRRYLVPAVVLLVVFIVLVLVIVPAIEYSMAGGHVLSTA
LGAITATPTPLPQYPLNQPVRIGDLQVTVTDARAGETQFNGNRFYTVTLTFQNYNASDTY
TIAAADFALTDGKGIYYTPSGGIQSKPSYDLSPDTTGIASVVYIVPQNSDKMQLLYTFPS
ATAAAPDKGRTQVAFIL
Download sequence
Identical sequences A7I9M6
gi|154151462|ref|YP_001405080.1| 456442.Mboo_1922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]