SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151463|ref|YP_001405081.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151463|ref|YP_001405081.1|
Domain Number 1 Region: 173-389
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.4e-27
Family RecA protein-like (ATPase-domain) 0.011
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000000701
Family PIN domain 0.039
Further Details:      
 
Domain Number 3 Region: 519-566
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000203
Family Prokaryotic type KH domain (KH-domain type II) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151463|ref|YP_001405081.1|
Sequence length 658
Comment ATPase [Methanoregula boonei 6A8]
Sequence
MILVPDTSVLIDGRITSMIKAGEYKGATIIVPEAVIAELEAQANNGREIGFSGLGELQSL
CRMAEEKTIELKFSGIRPTLEQVKLASGGEIDAMIRSIAIENAARFITSDNVQAEVARAK
GLDVIYLKPQITDFVPLGIDQFFDEHTIAVYLKERVPPSAKKGTINDMKLVKIRDQPVSE
YELRNLAQEILERAKRDPDGFIEVEKRGITVVQIGSMRIAIARRPFSDGMEITAVRPIVD
VTLDNYAKAEVIKKRIISDRRGLIIAGSPGAGKTTLAQSIAIFLSDNGYVVKTMEAPREL
QVPDQITQYTTLDGSMSNTADVLLLVRPDFVIFDELRKNEDFSVFADMRLAGLGMVGVIH
ANSVQDALQRFSDREDFSVLSQILNTIVFLEKGVVTKIYEVGFTIKVPEGMGSEMHIRPV
TTVTDLETGSLVLDIFRYDGQTIVMPVVPGVPAAPAAPTAKAATVQNAQPIPPVSRPGSS
LASIPDATPRAPQAEDRPGWKVNEKEIQREIGRYTDGEVEVEMISDTKAVVYIDDKDVPA
AIGKGGKNVSAIVNKIGIGIDIKPRSDLERQHTQQASAKPEGEISLGGGIKIQTDKKQLV
IIAPDQSGKIVDVFAGKEYLFTATVNETGEISLAKNSSIAQEMLRRYQNSETIRLRPV
Download sequence
Identical sequences A7I9M7
WP_012107492.1.2930 gi|154151463|ref|YP_001405081.1| 456442.Mboo_1923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]