SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151498|ref|YP_001405116.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151498|ref|YP_001405116.1|
Domain Number 1 Region: 2-251
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.7e-47
Family ADP-ribosylglycohydrolase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154151498|ref|YP_001405116.1|
Sequence length 270
Comment ADP-ribosylation/crystallin J1 [Methanoregula boonei 6A8]
Sequence
MRPGGRHFRRAGQYTDDTLQALAVAESLIACERFDPSDLVQRFLSGYRKRPEWYGPTSSA
FFDLVGSGTPPHHAAWLVHRRNGGSRTNGSVMRGFPLGIFYPADHAYTISIDCSRITHYD
TVAAHCSAWMTMMAADLCRGATRRRAFMHARSRCLNAEVLAVLGSFERYPRIPSLDAVQC
AHAALSCFMNARTFENALLAAVNLGGDADTVGACCGALAGAYWGMNAVPERWSRMIEGYD
ELIRIAGALWESREDRKEQRWRADNREFLP
Download sequence
Identical sequences A7I9R2
456442.Mboo_1958 gi|154151498|ref|YP_001405116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]