SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151503|ref|YP_001405121.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151503|ref|YP_001405121.1|
Domain Number 1 Region: 13-277
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.47e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000637
Further Details:      
 
Domain Number 2 Region: 278-401
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.19e-25
Family Anticodon-binding domain of Class II aaRS 0.0000692
Further Details:      
 
Domain Number 3 Region: 416-478
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.00000000104
Family C-terminal domain of ProRS 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154151503|ref|YP_001405121.1|
Sequence length 478
Comment prolyl-tRNA synthetase [Methanoregula boonei 6A8]
Sequence
METDTGALPKKQDFSEWYNEILWRAEIMDVRYPVKGLYVWFPYGFAIRKFVYQHLRELLD
RDHKETLFPLLIPEQEFMKEAEHIKGFEDEVYWVTHGGTTPLEVKLALRPTSETAIYPMF
ALWVRSHADLPIKIYQIVNTFRYETKQTRPLIRLREITSFMESHTVHATWDEAEIQVESE
IALTREFYRNLCIPIIISKRPDWDKFPGADYTIAVDAIMPNGKTLQIGTVHHLGNHFSRT
FNIQYEDKNGEQKEAYQTCYGISERCIAALISLHGDDKGLILPPTVATFQVVIVPITIGK
RHEDVLAAAGKLKNDLENAGLRVTLDTRDLRPGAKYYWWEIRGVPLRLELGPRDLDSGKA
MAVTRTGEKTTICLANAAEDTTSILTGITDAIRAKAGEHTKSHLCTTHTMDGLDIALNEG
KVAVVHWCRDRTCGDTIEEKANSSLLGTEVRSEYIEATDGPCIICGKPGKATLVGRTY
Download sequence
Identical sequences A7I9R7
WP_012107533.1.2930 gi|154151503|ref|YP_001405121.1| 456442.Mboo_1963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]