SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151625|ref|YP_001405243.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151625|ref|YP_001405243.1|
Domain Number 1 Region: 8-278
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.55e-48
Family ROO N-terminal domain-like 0.0000855
Further Details:      
 
Domain Number 2 Region: 245-387
Classification Level Classification E-value
Superfamily Flavoproteins 2.48e-24
Family Flavodoxin-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151625|ref|YP_001405243.1|
Sequence length 394
Comment beta-lactamase domain-containing protein [Methanoregula boonei 6A8]
Sequence
MVSRELVAGVYSVGAFDFDRRIFDELIPLPEGTSYNAYLIRGSEKTVLIDTVDPSKEYDL
ISNLVKMGIESIDYIVINHAEQDHSGSLPMILEFYPDARVVTNAKCRDLLIALLHIPSDR
FMVISEGETLSLGDRTLRFFLTPWTHWPETQITFLVEDKILFSCDLFGFHAATSELFITD
EAWAYRSAKRYYAEIMMPFRGSIKGYVEKVRGLDPVMIAPSHGPVHKNPKSILDAYAEWV
SDSVKNEVVIPYVSMHGSTAKMVDHLTGALIARGIVVKPFNLTRTDTGDLALALVDAATV
VFATPTVLFGPHPTVVSATYLANILRPKTRFASVIGSYGWGGKSVETITKMLDHVKVDLL
PPVMVNGEPGEAAMQDLDRLADEILKKHKEVNIV
Download sequence
Identical sequences A7IA39
WP_012107656.1.2930 456442.Mboo_2086 gi|154151625|ref|YP_001405243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]