SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151760|ref|YP_001405378.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151760|ref|YP_001405378.1|
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 5.89e-28
Family Ribosomal proteins L15p and L18e 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151760|ref|YP_001405378.1|
Sequence length 121
Comment 50S ribosomal protein L18 [Methanoregula boonei 6A8]
Sequence
MTRTVEKTNPRLTNLILLLKNTSRENEAKIWREIAGRLETPNRNYAEVNLSKINRYAQKG
ETIIVPGKVLGSGVLDQSVRIAALNFSESATSKIRDAKGQCMTIEQLLKDNPKGSGVRIL
R
Download sequence
Identical sequences A7IAH4
WP_012107795.1.2930 456442.Mboo_2221 gi|154151760|ref|YP_001405378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]