SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151761|ref|YP_001405379.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151761|ref|YP_001405379.1|
Domain Number 1 Region: 37-153
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.32e-34
Family Insert subdomain of RNA polymerase alpha subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 1-42,178-269
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.32e-26
Family RNA polymerase alpha subunit dimerisation domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151761|ref|YP_001405379.1|
Sequence length 276
Comment DNA-directed RNA polymerase subunit D [Methanoregula boonei 6A8]
Sequence
MEIEFASLDDTVARFTLSGAQPGFANSFRRAMIGEVPTLAIEDVRIYDNTSALFDEMLAH
RLGLIPIRTDLTSYSTQGDCSCGGAGCPSCTVTYTLSVEGPKLVTSSDLIPQDPQAAPVS
DNIPIVKLIKGQKLVIEARAVLNKGKVHAKWQPTLVCGYKNYPVITISPTCDACGMCVDE
CPRTILALKGKKVEVIEGRLPDCSMCKLCERACLASGIGEEPAIRISAEPDRYIFSVESD
GSLPVKEIMVQALGFVKAQAEELEKQTSEISGEEKK
Download sequence
Identical sequences A7IAH5
456442.Mboo_2222 WP_012107796.1.2930 gi|154151761|ref|YP_001405379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]