SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151948|ref|YP_001405566.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151948|ref|YP_001405566.1|
Domain Number 1 Region: 454-588
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-23
Family Histidine kinase 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|154151948|ref|YP_001405566.1|
Domain Number - Region: 301-351
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000131
Family HAMP domain 0.0094
Further Details:      
 
Domain Number - Region: 365-441
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00706
Family Homodimeric domain of signal transducing histidine kinase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154151948|ref|YP_001405566.1|
Sequence length 592
Comment integral membrane sensor signal transduction histidine kinase [Methanoregula boonei 6A8]
Sequence
MKVRTRSRLILAAMAFIFLIGLSFITQFVILDSFRSIEKQQMSANVERVIANLNDQEKIV
SANCRDWAGRDDTYAFAGAAGSSGNSSAFNQPLLLGTLDVDYLLIYNTSGDLVFSEGALN
PDGTEEVVPQQLDGIIKDSIIPAGVPGGVSGRHGASFLNGAPVILAGYSIKGSNQSAPSR
GTLVMVRVLNSKRIGDMESVLQIPAFTLAPASSGVSFGTFSDTDLQKMKKGGIVSQPVNN
SLMGGTAMISGIEDRPTFLVVQVFTDRMVYSDVQTSILIIAASIVALSAIFIIAVQFLLQ
RFVLGPLSALDNDMQIIGRSGDLSRRIPEKGDEEIVSVTRAFNQMLADLEENQEELSVAQ
DELAQHNRKLEELNRKANLYLDIYLDVITYEILNSIMGLRGYAEYLTETAGEKEKRFLKK
IVELAQKSSNVIRNIETISRIYKMQPGVVAVNLEEIIRKEAATRPDIQISVTNCNRRVLA
NDMLGVVFDNLFSNSLKFGGAGVAIEISATDNEQGVLEISVADNGPGIPDEMKPGIFDRF
AKDSKTRSSYGLGLHIVKMLMDGYGGRIWADDRIHGDPSSGVAIRFTLNLAE
Download sequence
Identical sequences A7IB12
456442.Mboo_2409 WP_012107985.1.2930 gi|154151948|ref|YP_001405566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]