SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154151006|ref|YP_001404624.1| from Methanoregula boonei 6A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154151006|ref|YP_001404624.1|
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily CheY-like 1.99e-30
Family CheY-related 0.0012
Further Details:      
 
Domain Number 2 Region: 292-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.03e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.067
Further Details:      
 
Domain Number 3 Region: 623-759
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-21
Family Histidine kinase 0.00056
Further Details:      
 
Domain Number 4 Region: 421-541
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.58e-20
Family Heme-binding PAS domain 0.012
Further Details:      
 
Domain Number 5 Region: 124-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-18
Family PYP-like 0.055
Further Details:      
 
Domain Number 6 Region: 541-610
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000353
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154151006|ref|YP_001404624.1|
Sequence length 768
Comment multi-sensor signal transduction histidine kinase [Methanoregula boonei 6A8]
Sequence
MITILYVDDEESLLELGKIFLERNGQFAVDIITSASEALTLIGQKPYDAIISDYQMPEMD
GIELLKHVRASGKTIPFILFTGRGREEVVIQALNEGADFYLQKGGSSLAQFTELAYKIRH
AVQKRWAETRLRDHERREADIINFLPDATFAIDKKGVIIAWNRAMEEMTGARPAEVLGKD
HYEHAFALYHKRRPMLADLILTPDPQFEEAEYLYTHHDQRTLMAETHVERPNGTRLHIWG
KASILLDEKGDVAGAIESIRDITEQKLAESELQTAYDEIAATEEEMRSQYLELVRSERQL
RESEEKYRELVETANSIIIKWDRSGIITFANEFALQFFGYTREELIGRSVMETIVPATES
GSEKDLTRMILDILNQPDVYVVNENENVCKNGTRVWIRWHNKPIFDNRGEFAGLFSIGTD
VTGRREIETALRESAAKYQGIFAAESDGIAVVDRETGIILECNDALAFMHGYLKEELPGQ
PITVLSAESDATSAAIAGATPFIRDRYHKKKDGNVFPVEITVNPTRLQGREVLIGAIRDV
TELRRSEEALQQANRSLALLTNVTRHDINNQLVALNGFLELLHEKVRDPALEEYFVWISQ
VSTRISSMIQFASTYETVRKTHPLWQDIRALAETTARQVSLGKVIIKNEIPAGIEVFADP
LFLKVFYNLVDNALRYGEKLTFIRFSFIERDNAGGVIVCEDDGEGVPEASKEKIFDRGYG
KNTGLGLFLAREILSLTGITVKETGEPGKGARFEITVPRDTYRFTGKS
Download sequence
Identical sequences A7I8C0
456442.Mboo_1463 gi|154151006|ref|YP_001404624.1| WP_012107018.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]