SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117927230|ref|YP_871781.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927230|ref|YP_871781.1|
Domain Number 1 Region: 15-288,493-559
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-81
Family Protein kinases, catalytic subunit 0.0000000132
Further Details:      
 
Domain Number 2 Region: 355-414
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 421-480
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117927230|ref|YP_871781.1|
Sequence length 582
Comment serine/threonine protein kinase [Acidothermus cellulolyticus 11B]
Sequence
MTSNDSLTNQPRRILADRYELGEILGYGGMAEVRRGRDLRLGRDVAIKTLRVDLARDTSF
QTRFRREAQAAAALNHPSIVAVYDTGESMLDGVPVPYIVMEYVEGRTLRDILKSESHILP
RRALEIVADILAALEYSHRNGIVHRDIKPGNIMLTHNGEVKVMDFGIARAVAQSTATVTQ
TAAVIGTAQYLSPEQARGEPVDPRSDIYSTGCVLYELLTGTPPFTGESAVAVAYQHVRED
PVPPSRLNPDVTPDIDAIVMKALAKNPANRYQSAAEMRADIERALLGKPVQATPLLLDPT
ERLSAVTEEIRPAQPRTRRGLIYTLLAVAVLALLVALGLLARQLITGSHATPTLPVPNVI
NMTQSQAEQTLTSDGFKVKVETQPNASVPQGIVFDQNPTAGTRLPKNSVVTITVSAGPKT
VTVPDLTNKSLEDARAALRALGLTVGNVTQRDSQQPAGTVLDQNPKPGSPAAAGSRVDLV
VASGTGTVPDVRGLPTSDAEQELTSAGYAYNVVEEPSNDVQQGFVINQVPGPGRTAPLGS
TVTLYVSSGTPSASPSSSASASPSPSGSPSSPAPSPSASSSP
Download sequence
Identical sequences A0LQT5
gi|117927230|ref|YP_871781.1| 351607.Acel_0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]