SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117927513|ref|YP_872064.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927513|ref|YP_872064.1|
Domain Number 1 Region: 6-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-61
Family G proteins 0.000000174
Further Details:      
 
Domain Number 2 Region: 305-397
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.74e-38
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000075
Further Details:      
 
Domain Number 3 Region: 207-304
Classification Level Classification E-value
Superfamily Translation proteins 9.03e-33
Family Elongation factors 0.0000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117927513|ref|YP_872064.1|
Sequence length 397
Comment elongation factor Tu [Acidothermus cellulolyticus 11B]
Sequence
MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDQNPDINPYTPFEQIDKAPEERA
RGITISIAHVEYQTEKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTKE
HVLLARQVGVPYIVVALNKADVVDDEEILQLVELEVRELLNSYEFPGDDVPVVRVSALKA
LEGDPKWTQSILDLLKACDDYIPEPVREIDKPFLMPIEDVFTITGRGTVVTGRVERGVVK
VGDEVEIVGIHPKTLKTTVTGVEMFRKLLDEGRAGDNIGVLLRGIKREEVERGQVVCKPG
SITPHTEFEAQVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNT
EMRVELIQPIAMEEGLRFAIREGGRTVGAGRVTKILK
Download sequence
Identical sequences A0LRL8
gi|117927513|ref|YP_872064.1| WP_011719141.1.7777 351607.Acel_0304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]