SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117927964|ref|YP_872515.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927964|ref|YP_872515.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily L21p-like 3.14e-27
Family Ribosomal protein L21p 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117927964|ref|YP_872515.1|
Sequence length 136
Comment 50S ribosomal protein L21 [Acidothermus cellulolyticus 11B]
Sequence
MYAIVRGGGRQHRVAVGDVIEINAAAKGATATVGATVELPAVLVVDGPSVTTGATALADI
TVTGEVVGHAKGPKIRILKYKNKTGYRRRVGHRQPLALVKVTHIGPRAAADRKTAPKRAS
AKAAADQTTAAQATAE
Download sequence
Identical sequences A0LSW9
351607.Acel_0756 WP_011719592.1.7777 gi|117927964|ref|YP_872515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]