SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117928039|ref|YP_872590.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928039|ref|YP_872590.1|
Domain Number 1 Region: 1-298
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.4e-65
Family Phase 1 flagellin 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117928039|ref|YP_872590.1|
Sequence length 298
Comment flagellar hook-associated protein 3 [Acidothermus cellulolyticus 11B]
Sequence
MSLRVTQNAVTSLMLAGLQSSSSRLSTLEQQLSSGRRISKPSDDPVGTGQAMLFNEQIAR
TKQYQRNANDGLAWLGIADNALQTGVNILQRLQVLTTQAANTGTADATARASILEEVKSL
KEQMLAVANTTYQNRPIFGGTTSSPVAYAVNGSGTVVYQGDTGSVLRTVGDNVQVKVNID
AAQAFGPPGNDVFTMFDTIASDLQNNPGNLSNDLSLIAGALDRMTSAQATEGAAYNRITA
MNNAAGQKLNTLTGNLSDVQDVDTAQAVTELTMQQVSYQASLAAMARVLQMSLTDFLR
Download sequence
Identical sequences A0LT44
gi|117928039|ref|YP_872590.1| 351607.Acel_0831 WP_011719667.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]