SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117928041|ref|YP_872592.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928041|ref|YP_872592.1|
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily FlgN-like 0.00000589
Family FlgN-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117928041|ref|YP_872592.1|
Sequence length 175
Comment hypothetical protein Acel_0833 [Acidothermus cellulolyticus 11B]
Sequence
MGEATEDPDEEVYRMGLAEVSDILWRERELLDVLLFKLEEEQLLLAAGKARWLARATREV
ELVLEQIRLTELTRAVEVDAVAATLGLEPNPSLAQLADAAPPPWSDLLRAHREAFLRLTQ
EITSLAEANREFVTSAYHSAEAALRSLRGATADGYTATGRLQSTTRSPRLLDEAI
Download sequence
Identical sequences A0LT46
351607.Acel_0833 gi|117928041|ref|YP_872592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]