SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117928194|ref|YP_872745.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928194|ref|YP_872745.1|
Domain Number 1 Region: 15-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.06e-77
Family Protein kinases, catalytic subunit 0.00000122
Further Details:      
 
Weak hits

Sequence:  gi|117928194|ref|YP_872745.1|
Domain Number - Region: 343-403
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 481-540
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117928194|ref|YP_872745.1|
Sequence length 612
Comment serine/threonine protein kinase [Acidothermus cellulolyticus 11B]
Sequence
MDTSVTDTLVGRLLDGRYLIEDRIARGGMATVYRARDMRLDRPVAVKVMHDVFATDPEFV
ARFIREAKAAAAFSHPNVVAVFDQGADGGHVYLVMEYVVGETLRDLLRRRGRLSPAEALG
ILQPVLAALSAAHASGLIHRDVKPENVLLARDGRVKVADFGLAQAVNRTASRTATLIGTV
AYLAPEQVTRGVADARSDVYAAGIMLFEMLTGAPPYQGDSPLAVAYRHAHEDVPPPSSRV
QSLPPAIDAVVLAATARDPDRRPADAHALLALVARARRELSTPDADGDAVTTLVPLSTET
LVVAGAPRRRRRWRMFVALLVVLAVAAAAGAAGWWLAVGRYAVVPRLVGVSTTQATELAA
KAHLRLHVAGETWSTTYPAGTIVDQRQRPESRVNRGTAIDVTVSKGRHLTTVPSFDPAQT
SLADYEAALAHAGLSAGPVTQRYDDTVPAGNVIATNPAAGDQVDWNSSVAITISQGRQPI
PVPDVRGQPADQAAATLQDAGFAVATSQAFSDTVPKGVVMSESPTPGGNGYRGDTVTLVV
SQGPQLFPVPKVTSTLADPSTWITIDQARQILESAGFTVHVGKKGRFGIVTHQDPAPGSM
EPKGFTVTIDAV
Download sequence
Identical sequences A0LTJ9
351607.Acel_0986 gi|117928194|ref|YP_872745.1| WP_011719822.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]