SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117928344|ref|YP_872895.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928344|ref|YP_872895.1|
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-42
Family ABC transporter ATPase domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117928344|ref|YP_872895.1|
Sequence length 252
Comment FeS assembly ATPase SufC [Acidothermus cellulolyticus 11B]
Sequence
MSTLEIRDLHVTVDSSDGEREILHGIDLTVRSGETHAIMGPNGSGKSTLAYALAGHPKYH
ITGGAVLLDGVDITTMKVDERARAGLFLAMQYPVEVPGVSVSNFLRTAVTALRGQAPKLR
AWVTEMKEAMNRLQIDASFADRNLNEGFSGGEKRRHEILQLELLNPKFAVLDETDSGLDI
DALKVVSEGINRFRADKEHGVLLITHYTRILRYVPPDHVHVVVDGRIAEEGGPELAERLE
AEGYERYVRATA
Download sequence
Identical sequences A0LTZ9
WP_011719972.1.7777 gi|117928344|ref|YP_872895.1| 351607.Acel_1137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]