SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117928465|ref|YP_873016.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928465|ref|YP_873016.1|
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.81e-19
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 90-155
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 3.66e-16
Family C-terminal domain of arginine repressor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117928465|ref|YP_873016.1|
Sequence length 184
Comment ArgR family transcriptional regulator [Acidothermus cellulolyticus 11B]
Sequence
MTTATPGTKAARHARIRELLAARSIRSQHELAELLAAEGFLVTQATLSRDLEEIGAVRLR
SVDGGFVYVVPSTEPPAASAAGRLARLAAELLISAEPSGNLVVVRTPPGGAHLLASAMDQ
AGLPDLLGTVAGDDTVLCVVRRPDGGAALARRLLDLAQRRGALTRARKRSASPHAGAEHE
GEIR
Download sequence
Identical sequences A0LUC0
351607.Acel_1258 gi|117928465|ref|YP_873016.1| WP_011720093.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]