SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117928667|ref|YP_873218.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928667|ref|YP_873218.1|
Domain Number 1 Region: 33-360,432-482
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.33e-79
Family Type II chitinase 0.000000232
Further Details:      
 
Domain Number 2 Region: 537-586
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000153
Family Carbohydrate binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 632-763
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000198
Family CBM4/9 0.023
Further Details:      
 
Domain Number 4 Region: 362-431
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000031
Family Chitinase insertion domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117928667|ref|YP_873218.1|
Sequence length 763
Comment glycosyl hydrolase family chitinase [Acidothermus cellulolyticus 11B]
Sequence
MQLTRRAAALAAATATLPVISLGLVSGLSAPAHAANGGIKVAYYDQWSIYLNAFYPKNLD
TSGIAGKLDFLIYDFENINPTTLQCFEATKAADQNESNPNAGDGAGDQYADMDKMYSADI
SVNGQADVWNQPVAGNFHQLQLLKAKYPNLKILLSIGGWTYSKYFSDAAATDASRKSFVS
SCIDMFIKGNLPKDSAGFGGPGVIAGLFDGIDIDWEYPASPDGHVGNHYSPADTANFTAL
LAEFRSELDAYGASVGRKMYLTAALPSGQDKIRLIQTDKIGQYLDFADVMTYDMHGAWDA
TGPTNFQDPLFESPNDPSTPVPPGSEHYAIDNAIRAYTGGDAAYGIPGGFPAAKINIGVP
FYYRGWTGVSAGSNHGLYQPATGPAPGHQYSGNVPGIAMYKELTGFVDNPAYTFWDPVTQ
AAWFYDGTTFYTGESAQSIRARTDYVHCKGLGGVMMFSLYDLDPSATLFNQVVNGLAATT
TSCPSPSSTPTVSSSPSPSPSSSPSPSPSSSLSPSPSPSSSPSPSSSPSPSPSSLPVCAP
AYDNSKVYVGGNVVSYNGHNWTAKWWTQGEPPSTGGSGVWQDNGPCATTSPSPSPSPSPS
PSPSPSPSPSPSPSPSPSPSPSPSPSPSASPSAGLVVNGGFETGDVSGWSCQAPDAVVGS
PVHSGRYALAGVPTGSTTGQCTQTVSVAPNTTYTVSAWVNGSYVYLGANGASGDVNTWTP
GTGGAYQQLTIRVTTGPTQTTMTVYIHGWYAQPTYYADDITLT
Download sequence
Identical sequences A0LUX2
351607.Acel_1460 gi|117928667|ref|YP_873218.1| WP_011720295.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]