SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117928996|ref|YP_873547.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117928996|ref|YP_873547.1|
Domain Number 1 Region: 148-337
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.18e-68
Family Methylesterase CheB, C-terminal domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily CheY-like 2.42e-25
Family CheY-related 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117928996|ref|YP_873547.1|
Sequence length 379
Comment response regulator receiver modulated CheB methylesterase [Acidothermus cellulolyticus 11B]
Sequence
MVIRRMLAAVLDEDPELEVVGTAANGRIALDKLPQLRPDAVVLDVEMPVLDGLATLRELR
RTHPRLPVIMFSTVTERGAQATLDALAAGASDYVTKPSKVSSVAASIARVRDDLIPKIKA
LVAARRGEARPTSADVRLAPAPPAAPGMVEALAIGCSTGGPDALASVVAHLPADLGVPVF
VVQHMPPLFTKLFAERLDRNCPMQVREAVDGEPAVAGRIYVAPGDTHLVVRRRAGQVVVH
LTKEPPENYCRPSVDVLFRSVASVYGARALACVLTGMGRDGLKGAERIHAAGGQIIVQDE
ATSVVWGMPGAIAAAGLASAVLPLPQIADALRRAIGRRPRVGSLRPASPPVADVAVAPAP
AARALPPYVPAVTIFGGLS
Download sequence
Identical sequences A0LVV1
351607.Acel_1789 WP_011720624.1.7777 gi|117928996|ref|YP_873547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]