SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117929211|ref|YP_873762.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117929211|ref|YP_873762.1|
Domain Number 1 Region: 251-273,305-696
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.33e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.001
Further Details:      
 
Domain Number 2 Region: 70-296
Classification Level Classification E-value
Superfamily Lysozyme-like 1.29e-72
Family PBP transglycosylase domain-like 0.0000119
Further Details:      
 
Weak hits

Sequence:  gi|117929211|ref|YP_873762.1|
Domain Number - Region: 702-764
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117929211|ref|YP_873762.1|
Sequence length 820
Comment glycosyl transferase family protein [Acidothermus cellulolyticus 11B]
Sequence
MATGTSTEGRLGPGRIFGHLLTLGFLALLTGALVAALALPVVGGAGLAVRDMIGNISFTD
LPPELQTPPLAQRSVILAADGTELATFYYENRQSVSLSDVAPDMREAIVAIEDARFYEHH
GIDPIGILRALIRDTSSGSAVQGASTITQQYVRQALVEINTQNENQAGAKAATAKTLSRK
LTEARYALALEQKLSKDQILEDYLNTVYFGSGAYGIAAAAQHYFSEDPSQLTLPQAALLA
GVVNNPSRFDPILNPQDALARRNVVLQRMADLHYITQAQADAAMQAPIGLKVSKIPNGCA
TSVAPFFCQYVVDEILNNPAFGPTRAARTNLLLRGGLTISTTLDMHMQAAAQNAVNTVIP
PDPTKNAGLAAAIDIVDPKTGAIRAMAVDRAFGSGEGETEVNLAADLAHGGSSGRHAGST
FKIFVLASALQQGIPTGLTLVSPNRITIKKGAMTDCNGAPTSEWNVANAGDSEAGTFDMV
QATKLSVNTYFAQLEEKTGLCKPIQIAEAMGVRQATGAPLDQVPSFVLGAEDVDPLTIAG
AFATLANQGTYCPPFAITAVTRQLGDTTTSIQVPASTCRRAIDPAIANGVTSLLTHVLEP
GGTGAGLGIGRPAAGKTGTDDEYRNAWFSGYTPNLAASVWVGNPDSTTPMRAITVNGHYY
REVFGATLAGPIWQKAMQEAVKNLPVQAFPQAPDSVLKGQPITVPDVAGQDPQTAVTTLQ
QLGLVVTVDPTPVYSDQPANTVAGTDPPAGSTVYVGNTITVHLSNGAGPSPSASLSPSAS
PSATESPSASPSPSASSSPPLIVPLPPPHHPGRGAPTPSG
Download sequence
Identical sequences A0LWG6
gi|117929211|ref|YP_873762.1| 351607.Acel_2004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]