SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117929238|ref|YP_873789.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|117929238|ref|YP_873789.1|
Domain Number - Region: 4-123
Classification Level Classification E-value
Superfamily FlgN-like 0.00392
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117929238|ref|YP_873789.1|
Sequence length 140
Comment hypothetical protein Acel_2031 [Acidothermus cellulolyticus 11B]
Sequence
MSQLAELSELLWRERQALDVLLFKLEEERLVLDAGRLEWLARAGHEVELAAEELRLAGLA
RAVGAEAVVEELRLAPTATLAEIAAAAPTPWGEMFAAHREAMLRLSARIDELAEANRRAV
EAARDAAVREARTATGELIW
Download sequence
Identical sequences A0LWJ3
351607.Acel_2031 gi|117929238|ref|YP_873789.1| WP_011720866.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]