SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117929266|ref|YP_873817.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117929266|ref|YP_873817.1|
Domain Number 1 Region: 222-410
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.01e-27
Family Prokaryotic proteases 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|117929266|ref|YP_873817.1|
Domain Number - Region: 7-213
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00471
Family Phase 1 flagellin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117929266|ref|YP_873817.1|
Sequence length 424
Comment peptidase S1 and S6, chymotrypsin/Hap [Acidothermus cellulolyticus 11B]
Sequence
MARFGSPGDTNSVAVTTEAPALTNREPVTDRPDNPETAGSTTATTDPAVTSAADSGDPAP
AATDHPTPADHTPSTGDALPTGEATPAGHTPSVGDAPPSGDATIVLPAHVGPGPEPSLPA
HRHGRRWLRAVLAALIVLAFGAAGTGLAWQQSQLAHLRSDVAALRAAQAEQVTALQSSLS
AQRQQISALSGQLVAARSALQNTQNQLKSDEERLNIATAQLPPDLTELAARVTPSVVLVS
CVSGTTTTSGTAFALALPQASGSQTTLVTAEHVVDGCTDPNSGVLSITAGNRSASAAVRA
YDAENDVALLDTSLRIPPLQPASNGPVVGEFVMAVGNALGIVVNNVTSGIISQVYPTYFL
DTAPISNGNSGGPVVDRSGNVLGIVDWGYASGTEAPLVENLNASLRLSVLCQKLLTGAVC
RSLH
Download sequence
Identical sequences A0LWM1
WP_011720894.1.7777 351607.Acel_2059 gi|117929266|ref|YP_873817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]