SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117927598|ref|YP_872149.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927598|ref|YP_872149.1|
Domain Number 1 Region: 203-342
Classification Level Classification E-value
Superfamily CBS-domain pair 3.66e-29
Family CBS-domain pair 0.0033
Further Details:      
 
Domain Number 2 Region: 350-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.72e-22
Family CorC/HlyC domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117927598|ref|YP_872149.1|
Sequence length 438
Comment hypothetical protein Acel_0389 [Acidothermus cellulolyticus 11B]
Sequence
MRSVWVDVVVVIALILLEALFVAAEIALVSLRESQIAALERRGRRGAAVARLARDPNRFL
SAVQIAITLTSLLSSAFGAVTLAHATADGLVSLGVTRDTGNVLGFLFVTIAISFVTLVIG
ELVPKRLALQRAEGTARLIAPTLDRLARFLTPVIALLSVTTNAIVRLLGGDPKAARESMS
EEELRGLVTSHEALGRDERQLIDEVFTAGDRRLREVLVPRTEVEFLDATMPVGQALAQLR
STMHSRYPVFRGSHDEIIGMVHVRDLLAAQAENRGRTVRVGDLVRPVKLLPDGLGVLQAL
SEMRREGHRLAVVVDEYGGTAGIVTLEDLVEEIIGEIRDEHAPDGVDASASGEMIVDGLT
HTEDFAEETGIRLPDGPYETVAGFMLAALGHIPGLGEWVDVDGYRFTVAELDGRRVAKIK
ITRRPTEAGSAARAALGE
Download sequence
Identical sequences A0LRV3
351607.Acel_0389 WP_011719226.1.7777 gi|117927598|ref|YP_872149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]