SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117927999|ref|YP_872550.1| from Acidothermus cellulolyticus 11B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117927999|ref|YP_872550.1|
Domain Number 1 Region: 196-343
Classification Level Classification E-value
Superfamily CBS-domain pair 6.32e-38
Family CBS-domain pair 0.0013
Further Details:      
 
Domain Number 2 Region: 338-426
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000128
Family CorC/HlyC domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117927999|ref|YP_872550.1|
Sequence length 483
Comment CBS domain-containing protein [Acidothermus cellulolyticus 11B]
Sequence
MVDAVLFTLAALLVVFAGACAMADSALSRVPRVHVEEFTRDGRRGAKSLAKVINDASHYL
NLVLLLRVTAEMTAAVIVAVAAVRIFGLHWPVVVVVSLVMVVVSYVVIGVAPRTIGRQHA
DGVSLAVAPVVYGLARVLGPLPRLLIAFGNAITPGRGFREGPFTTEAELRDLVDLAEKAR
VIEHGERQMIHSVFELGDTLVREVMVPRTDIVFIEKTKTLRQAMSLALRSGFSRIPVVGE
NEDDVVGIVYLRDLAKRIYEYREAETLERVESIMRPPVFVPDSKPIDELLREMQAARNHV
AIVVDEYGGTAGLVTIEDILEEIVGEITDEYDLERPRVEPLEDGTVRVTARLSIDELEEL
FGVQIDRTDHEVETVGGLLAQVLGRVPIPGARAAVAGLELIAEGAAGRRNKIATVLVRRL
PEAPEAAAETEHTAAAEPADAPGRGPSRADGGDPAVPSQPAENGAHDAGTPVAAAPRGDG
VRR
Download sequence
Identical sequences A0LT04
351607.Acel_0791 WP_011719627.1.7777 gi|117927999|ref|YP_872550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]