SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111017461|ref|YP_700433.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111017461|ref|YP_700433.1|
Domain Number 1 Region: 4-480
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.01e-202
Family Heme-dependent catalases 0.0000000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111017461|ref|YP_700433.1|
Sequence length 485
Comment catalase [Rhodococcus jostii RHA1]
Sequence
MTNPNGLTTVAGAPVPDNQNSLTAGARGPMLLQDVWLLEKLAHFDREVIPERRMHAKGSA
AFGTFRVTHDITAHTNAAVFSEIGKRTEVFLRFSTVAGERGAADAERDIRGFAVRFYTEQ
GNWDVVGNNTPVFFFRDPLKFPDLNHAVKRDPRTNLRSAENNWDFWTNLPEALHQITIVM
SDRGIPNGYRHMHGFGSHTFSFVNDAGERSWVKFHFRTQQGIKNLTDEEAAAVVAGDRES
AQRDLFNAIEEGNYPKWTLFVQIMPEADAQTYHYHPFDLTKVWSKKDYPLIEVGELELDR
NPENYHADVEQAAFSPANIVPGIGFSPDRMLQGRLFSYGDAARYRLGVNHHQIPVNSPRG
ATHVNSFHRDGVMRVDGNQGSVPSIEPNSHGRFADQRSYAEPPLEVGVVADRFDYRADDD
NYFEQPGNLFRSMSAEQQTLLFENTARAITGASAAVIERHIVNCAQADPAYGEGVRKACE
AFGAL
Download sequence
Identical sequences Q0SJL1
gi|111017461|ref|YP_700433.1| WP_011593712.1.78234 101510.RHA1_ro00439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]