SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111017526|ref|YP_700498.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111017526|ref|YP_700498.1|
Domain Number 1 Region: 387-463
Classification Level Classification E-value
Superfamily LCCL domain 5.62e-20
Family LCCL domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111017526|ref|YP_700498.1|
Sequence length 467
Comment hypothetical protein RHA1_ro00504 [Rhodococcus jostii RHA1]
Sequence
MSENPGSPGGPHWQPSGPEWQPQAQQWQPHAQQWPPAGGQPPGPPPPPPPRRSPGGGRWP
LLVGLIAAVLIGLLVGGYLLFVRGDADEGEVLLEAAASEGPFPWTPPVVPPDAPTTLPES
MPTMAPSAPDPGRPGLIAVPGDRTGIYGGSLELSVCDKPKLIGFLEQNPGQRAAFGEVLG
ITDVRAFVESLTPVILGSDTRVTNHGYENDRPTPLQSVLQAGTAVLVDDRGVPRVRCQCG
NPLLPPQPTKAAPTYTGQRWPGFEPDKIVVVQSAPTPVTQLTVINIVTGAPVVINVGSGT
PQQPTTTPTRTTTAPPPPLRTTAAPPPPLRTTVAPPPPLRTTAAPPPPPRTTMAPPPRTQ
PPTTQALPPADWSTTAEAFRGQDGGRASFDCPPGGTFGSVWGSGTYTDDSSVCTAGVHAG
VISQQSGGVVIIEISPGLGSYQGSTANGVTSQDWGNWYGSFQVAGGG
Download sequence
Identical sequences Q0SJE6
gi|111017526|ref|YP_700498.1| 101510.RHA1_ro00504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]