SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111017910|ref|YP_700882.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111017910|ref|YP_700882.1|
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily PEBP-like 1.83e-46
Family Prokaryotic PEBP-like proteins 0.0000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111017910|ref|YP_700882.1|
Sequence length 176
Comment hypothetical protein RHA1_ro00891 [Rhodococcus jostii RHA1]
Sequence
MSHDPYEALPDLPSFELTSTDVTDGQPLNKEQVSGIFGAGGYDNSPQLSWSGFPAETKSF
AVTVYDPDAPTASGFWHWAVANIPADTTTLVSGAGDDDGTGLPSGAITLKNDAGLRRFLG
AAPPEGHGPHRYIFAVHALDVETLDGVTADSTPAFLGFNLFSHAIARATIQGTYEQ
Download sequence
Identical sequences J1RAD6 Q0SIB2
WP_009473565.1.60566 WP_009473565.1.78234 101510.RHA1_ro00891 gi|111017910|ref|YP_700882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]