SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111018105|ref|YP_701077.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111018105|ref|YP_701077.1|
Domain Number 1 Region: 127-338
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.62e-54
Family MurCDEF 0.0000601
Further Details:      
 
Domain Number 2 Region: 345-488
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.45e-29
Family MurCDEF C-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 2.35e-17
Family MurE/MurF N-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111018105|ref|YP_701077.1|
Sequence length 504
Comment UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [Rhodococcus jostii RHA1]
Sequence
MIPMTLARIAEIVGGELHDVADPSAEVTGTVEFDSRKVTAGGLFLALPGAHVDGHDHAAS
AVEAGVVAVLAARPVGVPAIVVTPTPSDVPSKAMALEHDTDGSGAAVLAALAKLARASVD
GLTAKGLTVVGVTGSAGKTSTKDLLAAVLRPLGPVVAPPGSFNNELGHPWTALRADADTG
FLVLEMSARGRGHIASLANIAPPKIGVVLNVGTAHLGEFGSRDAIAAAKGELAESLPSAD
EGGVAILNADDPLVAAMAPRTSARVVLVGRSESAHVRATDIVLDEKARARFTLTAPTGSV
AVELAVHGEHQVGNALAAAAVALECGADLEQIAQALSGAAAVSARRMDVRDRPDGVTVVN
DSYNANPDSMRAALKALVSMARSGRGAARRSWAVLGEMAELGPESVVEHDAIGRFAVRLD
VSRLIIVGTGRPARAMHQGAVMEGSWGEESILVPDIAGAVALLEAELAPGDLVLVKASQS
IGLWEVADTVLAGSTGQKGSEATR
Download sequence
Identical sequences Q0SHR7
101510.RHA1_ro01092 gi|111018105|ref|YP_701077.1| WP_011594226.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]