SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111018422|ref|YP_701394.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111018422|ref|YP_701394.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.51e-100
Family FMN-linked oxidoreductases 0.00000000559
Further Details:      
 
Domain Number 2 Region: 334-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.89e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000199
Further Details:      
 
Domain Number 3 Region: 462-520,555-652
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.73e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111018422|ref|YP_701394.1|
Sequence length 674
Comment 2,4-dienoyl-CoA reductase [Rhodococcus jostii RHA1]
Sequence
MTQFPQLLAPLDLGFTTLKNRVIMGSIHTGLEDRAKDVPRLAEYFAERARGGVALIVTGG
YAPNRTGWLLPFGAKLTNRVEARRHRAITKAVHDEGGKIALQILHAGRYSYQPFSVSASS
IKAPINPFRPRKLTGRGVRWQIRNFVRCARLAQQANYDGVEIMGGEGYFINQFLCERTNK
RTDKWGGTPENRRRMAVEIVRRTRKAVGPNFIIIFRLSMADLVEGGQTWDEIVALAQEVE
AAGATIINTDIGWHESRVPTIVTSVPRAAFADITGKLEKHVSIPVAASNRINMPEVAEEI
LTRGDAQLISMARPMLADPDWVRKAEAGTPDEINTCIACNQACLDHAFVRKHVSCLLNPR
AGRETELTLSPTRAAKRVAVVGAGPAGLSAALGLAQRGHSVTLFEADSEIGGQFGIARKI
PGKEEFAETIRYYNRQLPLAGVDVRLDSRVTATELIGEYDEVIVATGVTPRVPSIPGIDH
PKVLTYPEVVRGGKPVGQSVAVIGAGGIGVDVSEFLTHEHSPTLDLKEWKQEWGVTEPEA
AAGALTTPIPEPSPREVYLLQRKSGRIGAGLAKTTGWVHRAALKNKGVQELSGVNYERID
DDGLHITFGAKREKPRTLAVDNVVICAGQESVRDLVDELTVAGVTTHVIGGADVAAELDA
KRAIEQGTRLAARI
Download sequence
Identical sequences Q0SGV0
gi|111018422|ref|YP_701394.1| 101510.RHA1_ro01415 WP_011594437.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]