SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111020408|ref|YP_703380.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111020408|ref|YP_703380.1|
Domain Number 1 Region: 66-566
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 6.54e-200
Family Heme-dependent catalases 0.0000000000499
Further Details:      
 
Domain Number 2 Region: 588-724
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000865
Family Catalase, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111020408|ref|YP_703380.1|
Sequence length 726
Comment catalase [Rhodococcus jostii RHA1]
Sequence
MRRRSHGFSARSYAVPKKNPPIPGTPGSGTPTLAEPTEPTEPLPPKPDQRAPALGSATGQ
PVEGPDTARGQQGEHLTTSQGARLYDTDHSLKAGTRGPTLLQDHHLREKITHFDHERIPE
RVVHARGAAAHGVFRGYGSADPISKAAFLGKDVETPVFVRFSTVLGSRGSADAVRDTRGF
ATKFYTGEGTFDMVGNNIPVFFIQDGIKFPDVVHAAKPHPDREIPQAQSAHDTFWDFVSL
HTEATAHTLWNMSDRGIPRSYRMMEGFGVNTFRMVNAAGESSLVKFHWKPKLGVHSLVWE
EAQIVNGMDPDYHRRDLADAIESGAYPEWELGIQAFPDTPDQTFEGIDLLDPTKMVPEEL
APVQPIGLMTLDANPTNFFAETEQVAFHPGHLVPGIDVTDDPLLQARLFSYLDTQISRLG
GPNFGQIPINRPQADVNDMLRDGMHQTGVHPGVAPYRPNSLDAGCPFLAGADTAFVEVPV
PMPESTKLRAAPASFDDHFSQARLFYASLSPVEQAHVAEAYTFELGKCYEQVIKERALEV
VANIDPELCEQVAAGLGLPAPAPTVAYDAAPTPSPALSQVGAEWPLDGRIIGIVADDESD
LSEVADAVEMIGKNGMVPLVIGPHGGKLGSGKGAVPVSRTFLTMRSVEFDAILVAAPASD
PRVQVLLTEAFRHCKAIGGWAAGRGLLEAAGISAEAPGIVIADDASALFDGLTALMKSHR
VWERQV
Download sequence
Identical sequences Q0SB64
101510.RHA1_ro03419 gi|111020408|ref|YP_703380.1| WP_011596056.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]