SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111021195|ref|YP_704167.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111021195|ref|YP_704167.1|
Domain Number 1 Region: 51-282
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 4.58e-31
Family MurCDEF 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111021195|ref|YP_704167.1|
Sequence length 417
Comment UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodococcus jostii RHA1]
Sequence
MSTGTGITTRGKLALRAAAAASWASQKAGRGKGSMIGGLIALKIDPTLMEQLGAGRRTAV
ITGTNGKSTTTRMTAAALSTLGEVATQADGANMDAGIVAALSTRVHAPLAALEVDELHVP
HVSDAVNPEALVLLNLSRDQLDRVGEINMIERKLRACVAAHPEAVVIANCDDVLVTSVAY
DAKNVVWVAAGGGWASDAASCPRTGEPIVWEGSHWRSTGSDFARPTPDWWLDDENLYGPD
GLKIPMTLALPGRANRGNAAQAVAAAVAMGAKAEDAVAAAATVQEVAGRYSTVEVGSHSV
HMLLAKNPAGWQEALSMIDPTVDGLVIAVNGQVPDGEDLSWLWDVRFEHFEGVKVVAAGE
RGTDLAVRLTYAGVEHTLDPNPLRAIASCPPGRVEVLANYTAFRDLNTAIAKEARNA
Download sequence
Identical sequences I0WQB2 J2JBT4 K8XT54 L2TTL4 Q0S8X7
101510.RHA1_ro04218 WP_005253380.1.100430 WP_005253380.1.11008 WP_005253380.1.11980 WP_005253380.1.19668 WP_005253380.1.53434 WP_005253380.1.59368 WP_005253380.1.60566 WP_005253380.1.65071 WP_005253380.1.78234 gi|111021195|ref|YP_704167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]