SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111022799|ref|YP_705771.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111022799|ref|YP_705771.1|
Domain Number 1 Region: 7-484
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.49e-212
Family Heme-dependent catalases 0.00000000000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111022799|ref|YP_705771.1|
Sequence length 487
Comment catalase [Rhodococcus jostii RHA1]
Sequence
MSRETTANTSDKLTTAVGAPVPDNQNVVTAGPRGPQLLQDVWFLEKLAHFDREVIPERRM
HAKGSGAYGTFTVTNDITRYTSAKIFSEVGKKTELFARFSTVAGERGAADAERDIRGFAV
KFYTEEGNWDLVGNNTPVFFFRDPLKFPDLNHAVKRDPRTNLRSPDNNWDFWTSLPESLH
QVTIVMSDRGIPSSYRHMHGFGSHTFSFINTEGERFWVKFHHRVQQGVENLTDAEAEALV
GADRESHQRDLFDAIEAGNFPKWKLCVQIMPEADADTVPYHPFDLTKVWPKADYPLIEVG
EWELNRNPDNYFAEVEQAAFNPAHVVPGISFSPDKMLQGRLFSYGDAQRYRLGVNNYQIP
VNAARCPVSNFHRDGAMRVDGNNGGTLHYEPNSYGKWQEQSRYRDPAQGVGAFADRFNFR
EDDDDYFSQPRVLFNNMSDEQKQVLFENTARAINGASQQVVQRHIDNCTQCDPAYGEGVA
KAISALG
Download sequence
Identical sequences Q0S4C3
101510.RHA1_ro05836 gi|111022799|ref|YP_705771.1| WP_011597939.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]